Product Overview

Human erythropoietin (EPO) is a naturally occurring hormone secreted mainly by the kidney. It regulates erythropoiesis by stimulating the survival, proliferation, and differentiation of erythroid precursor cells in the bone marrow, resulting in increased red blood cell production.

EPO plays an essential role in oxygen transport regulation and hematopoietic research. Recombinant human EPO (rhEPO) is widely studied for applications related to erythroid cell development, anemia mechanisms, and protein expression analysis.

This product is an unmodified Human EPO mRNA synthesized using in vitro co-transcriptional capping technology. The mRNA has a theoretical length of 848 nt and encodes the full-length human EPO protein.

The product is purified through precipitation and desalting processes and exhibits stable translation efficiency in mammalian eukaryotic cells, making it suitable for protein expression studies, cellular assays, and animal research.

Amino Acid Sequence of Encoded Protein

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR*

Key Features

Reliable Protein Expression

Human EPO mRNA efficiently expresses functional EPO protein in mammalian eukaryotic cells.

High-Quality mRNA Preparation

Produced by in vitro co-transcriptional capping and purified through precipitation and desalting to ensure product quality.

Excellent Stability

Stable for at least 1 month at 2–8°C

Resistant to more than 10 freeze-thaw cycles

Suitable for long-term storage at -80°C

Validated Cellular Expression

Protein expression capability has been confirmed through cellular expression assays.

Complete Product Support

• Short lead time

• Reliable batch supply

• Customization services available

Applications

Human EPO mRNA is suitable for:

• Recombinant protein expression studies

• Mammalian cell transfection experiments

• EPO biological function research

• Hematopoietic differentiation studies

• Cell-based assay development

• mRNA delivery platform evaluation

• In vivo animal experiments

Performance Data

Detection of Human EPO Protein Expression by Western Blot Analysis

Detection of Intracellular and Secreted hEPO Expression by Western Blot

Stability of Human EPO mRNA Bulk Solution at 2–8°C

The product maintains stable mRNA quality during refrigerated storage.

Freeze-Thaw Stability of Human EPO mRNA Bulk Solution

The product remains stable after repeated freeze-thaw cycles, supporting routine experimental workflows.

Long-Term Stability of Human EPO mRNA Bulk Solution at -80°C

Ultra-low temperature storage maintains product integrity and expression performance.

FAQ

Q1: What is Human EPO mRNA used for?

A: Human EPO mRNA is commonly used for studying EPO protein expression, erythropoiesis pathways, hematopoietic differentiation, and mRNA delivery technologies.

Q2: What is the length of this mRNA?

A: The theoretical length of Human EPO mRNA is approximately 848 nt.

Q3: What are the storage conditions?

A: Recommended storage temperature is -85°C to -65°C.

Q4: What are the shipping conditions?

A: Transportation is supported under -45°C to 25°C conditions.

Q5: Is customization available?

A: Yes. Custom sequence, modification, and manufacturing services are available according to research requirements.

Related Products