Product Overview

Fluc saRNA (Firefly Luciferase Self-Amplifying RNA) is an advanced RNA reporter system designed for highly sensitive monitoring of gene expression and RNA delivery performance. Following transfection into mammalian cells, Fluc saRNA expresses firefly luciferase, which catalyzes the oxidation of luciferin to generate bioluminescence signals. The emitted light can be rapidly detected and quantitatively analyzed, providing a simple, sensitive, and non-destructive method for evaluating protein expression.

Compared with conventional mRNA, self-amplifying RNA (saRNA) contains RNA-dependent RNA polymerase (RDRP)-derived replicase elements that enable intracellular RNA amplification. Through the action of the subgenomic promoter (SGP), the target gene of interest (GOI) is efficiently transcribed and translated, resulting in enhanced protein production with significantly reduced RNA dosage requirements.

Fluc saRNA enables a 30–1000-fold reduction in RNA dosage compared with standard mRNA while maintaining strong and sustained protein expression. This makes it a powerful tool for evaluating RNA delivery systems, studying gene expression regulation, and optimizing next-generation RNA therapeutics.

This product is synthesized through in vitro co-transcriptional capping without modified nucleotides, followed by precipitation and desalting purification. With a theoretical length of approximately 9.4 kb, Fluc saRNA demonstrates stable translation efficiency in mammalian cells and is suitable for both cell-based assays and in vivo animal studies.

Amino Acid Sequence of Encoded Protein：

MREAQTNYLPKMEKVHVDIEEDSPFLRALQRSFPQFEVEAKQVTDNDHANARAFSHLASKLIETEVDPSDTILDIGSAPARRMYSKHKYHCICPMRCAEDPDRLYKYATKLKKNCKEITDKELDKKMKELAAVMSDPDLETETMCLHDDESCRYEGQVAVYQDVYAVDGPTSLYHQANKGVRVAYWIGFDTTPFMFKNLAGAYPSYSTNWADETVLTARNIGLCSSDVMERSRRGMSILRKKYLKPSNNVLFSVGSTIYHEKRDLLRSWHLPSVFHLRGKQNYTCRCETIVSCDGYVVKRIAISPGLYGKPSGYAATMHREGFLCCKVTDTLNGERVSFPVCTYVPATLCDQMTGILATDVSADDAQKLLVGLNQRIVVNGRTQRNTNTMKNYLLPVVAQAFARWAKEYKEDQEDERPLGLRDRQLVMGCCWAFRRHKITSIYKRPDTQTIIKVNSDFHSFVLPRIGSNTLEIGLRTRIRKMLEEHKEPSPLITAEDVQEAKCAADEAKEVREAEELRAALPPLAADVEEPTLEADVDLMLQEAGAGSVETPRGLIKVTSYDGEDKIGSYAVLSPQAVLKSEKLSCIHPLAEQVIVITHSGRKGRYAVEPYHGKVVVPEGHAIPVQDFQALSESATIVYNEREFVNRYLHHIATHGGALNTDEEYYKTVKPSEHDGEYLYDIDRKQCVKKELVTGLGLTGELVDPPFHEFAYESLRTRPAAPYQVPTIGVYGVPGSGKSGIIKSAVTKKDLVVSAKKENCAEIIRDVKKMKGLDVNARTVDSVLLNGCKHPVETLYIDEAFACHAGTLRALIAIIRPKKAVLCGDPKQCGFFNMMCLKVHFNHEICTQVFHKSISRRCTKSVTSVVSTLFYDKKMRTTNPKETKIVIDTTGSTKPKQDDLILTCFRGWVKQLQIDYKGNEIMTAAASQGLTRKGVYAVRYKVNENPLYAPTSEHVNVLLTRTEDRIVWKTLAGDPWIKTLTAKYPGNFTATIEEWQAEHDAIMRHILERPDPTDVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNSYKLSSTLTNIYTGSRLHEAGCAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREAVEEICISDDSSVTEPDAELVRVHPKSSLAGRKGYSTSDGKTFSYLEGTKFHQAAKDIAEINAMWPVATEANEQVCMYILGESMSSIRSKCPVEESEASTPPSTLPCLCIHAMTPERVQRLKASRPEQITVCSSFPLPKYRITGVQKIQCSQPILFSPKVPAYIHPRKYLVETPPVDETPEPSAENQSTEGTPEQPPLITEDETRTRTPEPIIIEEEEEDSISLLSDGPTHQVLQVEADIHGPPSVSSSSWSIPHASDFDVDSLSILDTLEGASVTSGATSAETNSYFAKSMEFLARPVPAPRTVFRNPPHPAPRTRTPSLAPSRACSRTSLVSTPPGVNRVITREELEALTPSRTPSRSVSRTSLVSNPPGVNRVITREEFEAFVAQQQ*

MKAITARRILQGLGHYLKAEGKVECYRTLHPVPLYSSSVNRAFSSPKVAVEACNAMLKENFPTVASYCIIPEYDAYLDMVDGASCCLDTASFCPAKLRSFPKKHSYLEPTIRSAVPSAIQNTLQNVLAAATKRNCNVTQMRELPVLDSAAFNVECFKKYACNNEYWETFKENPIRLTEENVVNYITKLKGPKAAALFAKTHNLNMLQDIPMDRFVMDLKRDVKVTPGTKHTEERPKVQVIQAADPLATAYLCGIHRELVRRLNAVLLPNIHTLFDMSAEDFDAIIAEHFQPGDCVLETDIASFDKSEDDAMALTALMILEDLGVDAELLTLIEAAFGEISSIHLPTKTKFKFGAMMKSGMFLTLFVNTVINIVIASRVLRERLTGSPCAAFIGDDNIVKGVKSDKLMADRCATWLNMEVKIIDAVVGEKAPYFCGGFILCDSVTGTACRVADPLKRLFKLGKPLAADDEHDDDRRRALHEESTRWNRVGILSELCKAVESRYETVGTSIIVMAMTTLASSVKSFSYLRGAPITLYG*

MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIREILIKAKKGGKIAV*

Key Features

Enhanced Protein Expression Through Self-Amplification

Fluc saRNA utilizes an RNA self-amplification mechanism mediated by replicase elements, enabling prolonged intracellular expression and higher protein production compared with conventional mRNA.

Highly Sensitive Luciferase Reporter System

Firefly luciferase provides strong bioluminescence signals after luciferin substrate reaction, enabling rapid and quantitative assessment of:

• RNA delivery efficiency

• Protein expression levels

• Gene regulation mechanisms

• Transfection performance

Excellent Stability and Storage Performance

• Stable for at least 1 month at 2–8°C

• Tolerates more than 10 freeze-thaw cycles

• Maintains reliable translation activity after long-term storage at ultra-low temperatures

Validated Cellular Expression Performance

Cell-based expression assays demonstrate robust protein production, with higher expression levels compared with conventional reporter RNA products.

Flexible Supply and Customization Services

• Reliable batch-to-batch consistency

• Short lead time

• Custom saRNA design and production services available

Applications

Fluc saRNA is widely used as a sensitive reporter tool for RNA research, gene expression analysis, and delivery system evaluation.

Main applications include:

RNA Delivery System Evaluation

• Screening and optimization of lipid nanoparticles (LNPs)

• Evaluation of RNA transfection efficiency

• Comparison of RNA delivery platforms

Gene Expression and Regulation Studies

• Monitoring intracellular protein expression

• Studying regulatory elements affecting translation

• Evaluating RNA amplification efficiency

Cell-Based Reporter Assays

• Quantitative analysis of gene expression

• High-throughput screening applications

• Functional validation of RNA constructs

In Vivo Expression Studies

• Animal model studies

• Evaluation of RNA biodistribution and expression duration

• Development of RNA-based therapeutics and vaccines

Performance Data

Cellular Translation Performance of Fluc saRNA

Fluc saRNA demonstrates strong and sustained luciferase expression in mammalian cells.

Compared with conventional mRNA systems, saRNA technology enables enhanced intracellular RNA amplification, resulting in improved protein expression efficiency at lower RNA doses.

Evaluation method:

Cell transfection followed by luciferase bioluminescence detection.

In Vivo Expression Performance

Fluc saRNA enables effective luciferase expression in animal models, providing a sensitive platform for monitoring RNA delivery efficiency and protein expression dynamics in vivo.

Long-Term Stability of mRNA Bulk Solution

Fluc saRNA maintains structural integrity and translation activity during long-term storage under recommended conditions.

FAQ

Q1. What is Fluc saRNA?

Fluc saRNA is a self-amplifying RNA encoding firefly luciferase. After delivery into cells, it produces luciferase protein, which generates measurable bioluminescence through luciferin oxidation. It is commonly used as a reporter system for RNA expression and delivery studies.

Q2. What are the advantages of saRNA compared with conventional mRNA?

Unlike conventional mRNA, saRNA contains replicase elements that enable intracellular RNA amplification. This allows stronger and longer-lasting protein expression with significantly lower RNA doses.

Q3. What is the recommended storage condition?

Fluc saRNA should be stored at -85°C to -65°C for long-term storage.

Q4. How should Fluc saRNA be transported?

The recommended transportation temperature range is -45°C to 25°C. For optimal product performance, avoid unnecessary temperature fluctuations.

Q5. Does Fluc saRNA contain modified nucleotides?

No. This product is synthesized through in vitro co-transcriptional capping without modified nucleotides.

Q6. Can Fluc saRNA be customized?

Yes. Customization services are available, including sequence design, production scale adjustment, and formulation optimization according to research requirements.

Related Products