Product Overview

COVID-19 RBD (1000 nt) mRNA is an in vitro transcribed mRNA encoding the receptor-binding domain (RBD) of the SARS-CoV-2 spike (S) glycoprotein. The RBD region is a critical functional domain responsible for interaction with the host cell angiotensin-converting enzyme 2 (ACE2) receptor, which plays an essential role in viral attachment and entry.

The SARS-CoV-2 RBD domain is widely used as an important research model for studying virus-host interactions, immune recognition, neutralizing antibody responses, and viral evolution. Mutations within the RBD region may influence viral infectivity, transmissibility, and immune escape properties, making RBD-based mRNA products valuable tools for COVID-19-related research.

This product is synthesized through an advanced in vitro transcription (IVT) process with co-transcriptional capping technology and purified by precipitation and desalting procedures. With a theoretical transcript length of approximately 1050 nt, COVID-19 RBD mRNA provides efficient translation capability in mammalian cells and supports applications in cellular expression studies and animal model research.

Encoded Protein Amino Acid Sequence:

MDAMKRGLCCVLLLCGAVFVSARVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFHHHHHH*

Key Features

High-Quality mRNA with Efficient Translation Performance

• Encodes the SARS-CoV-2 RBD protein for reliable protein expression studies.

• Optimized mRNA design supports efficient translation in mammalian cells.

• Suitable for functional expression and immunological research applications.

Excellent Product Stability

• Stable for at least 1 month at 2–8°C.

• Maintains product integrity after more than 10 freeze-thaw cycles.

• Supports flexible laboratory handling and experimental workflows.

Validated Cellular Expression Performance

• Verified through mammalian cell-based expression assays.

• Demonstrates strong protein expression capability compared with competitive products.

Reliable Supply and Customization Service

• Short lead time to support research projects.

• Custom mRNA design and production services available upon request.

Applications

COVID-19 RBD (1000 nt) mRNA is suitable for a broad range of SARS-CoV-2-related research applications, including:

• Cell-based protein expression studies

• Virus-host interaction research

• Immune response and antibody research

• Vaccine candidate evaluation

• Antigen expression studies

• In vivo animal model experiments

• mRNA technology development and validation

Performance Data

mRNA Bulk Solution Stability at 2–8°C

COVID-19 RBD (1000 nt) mRNA maintains stability during refrigerated storage, supporting short-term transportation and laboratory use.

Freeze-Thaw Stability Evaluation

The product retains mRNA integrity and functional performance after repeated freeze-thaw cycles, demonstrating strong operational stability.

Long-Term Stability at -80°C

Long-term storage assessment confirms stable preservation of mRNA quality and translation activity under ultra-low temperature conditions.

FAQ

Q1. What is the recommended storage condition for COVID-19 RBD (1000 nt) mRNA?

The recommended storage temperature is -85°C to -65°C.

Q2. How should the product be transported?

The product can be transported under controlled temperature conditions ranging from -45°C to 25°C.

Q3. Is this product suitable for in vivo studies?

Yes. COVID-19 RBD (1000 nt) mRNA is suitable for both cell-based assays and in vivo animal studies.

Q4. Can customized mRNA products be provided?

Yes. Customized mRNA sequences, modifications, and production services are available according to project requirements.

Related Products