Product Overview

eGFP mRNA is an in vitro transcribed messenger RNA encoding enhanced green fluorescent protein (EGFP), a widely used fluorescent reporter protein for monitoring gene expression and protein localization in living cells.

EGFP is an optimized variant of green fluorescent protein (GFP) with an excitation wavelength of 488 nm and an emission wavelength of 507 nm. Compared with conventional GFP, EGFP exhibits significantly enhanced fluorescence intensity, enabling sensitive and direct visualization of protein expression through fluorescence microscopy without additional substrates or cell disruption.

This product is synthesized by in vitro co-transcriptional capping technology and purified through precipitation and desalting processes. With a theoretical length of approximately 997 nt, eGFP mRNA enables efficient protein translation in mammalian eukaryotic cells and serves as a reliable reporter molecule for cell-based research applications.

The encoded EGFP protein sequence is:

Amino Acid Sequence of Encoded Protein：

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*

Key Features

High Fluorescence Signal for Sensitive Detection

Encodes enhanced green fluorescent protein (EGFP) with stronger fluorescence intensity than conventional GFP, enabling efficient visualization of mRNA translation and protein expression.

Reliable Translation Performance in Mammalian Cells

Optimized mRNA design supports robust protein expression after transfection into mammalian cells, making it suitable as a reporter gene for functional studies.

Stable and High-Quality mRNA Preparation

Purified through precipitation and desalting processes, ensuring consistent product quality and reliable performance in cell-based assays.

Ready-to-Use Research Solution

Available for a wide range of molecular biology applications, with customization services available to meet different experimental requirements.

Applications

eGFP mRNA is suitable for applications including:

• mRNA transfection efficiency evaluation

• Reporter gene assays

• Gene expression and regulation studies

• Cell differentiation and development research

• Protein localization and intracellular trafficking studies

• Fluorescence microscopy-based cellular imaging

• In vivo animal model studies

Performance Data

Time-Dependent eGFP Protein Expression in Various Cell Lines - eGFP mRNA

Stability of eGFP mRNA Bulk Solution at 2–8°C

The product maintains stable performance during refrigerated storage conditions, supporting short-term handling and transportation requirements.

Freeze-Thaw Stability of eGFP mRNA Bulk Solution

The mRNA maintains integrity and functional expression activity after multiple freeze-thaw cycles, demonstrating good operational stability.

Long-Term Stability at -80°C

The product supports long-term storage at ultra-low temperatures while maintaining mRNA quality and translation performance.

FAQ

Q1: What is eGFP mRNA used for?

eGFP mRNA is primarily used as a fluorescent reporter molecule to evaluate mRNA delivery, translation efficiency, gene expression, and protein localization in cells.

Q2: What is the difference between eGFP mRNA and eGFP protein?

eGFP mRNA provides the genetic template for cells to produce EGFP protein after transfection, enabling real-time evaluation of mRNA expression performance.

Q3: What is the recommended storage condition for eGFP mRNA?

The recommended storage condition is -85°C to -65°C. During transportation, the product can be shipped under -45°C to 25°C conditions.

Q4: How many freeze-thaw cycles can eGFP mRNA tolerate?

eGFP mRNA maintains functional stability after more than 10 freeze-thaw cycles under recommended conditions.

Related Products