Product Overview

mCherry mRNA (modified) encodes mCherry red fluorescent protein, a highly optimized fluorescent reporter derived from coral-derived DsRed variants. With rapid maturation, strong fluorescence intensity, and excellent photostability, mCherry is widely used for real-time monitoring of gene expression, protein localization, and mRNA delivery performance.

The encoded mCherry protein has a maximum excitation wavelength of approximately 587 nm and maximum emission wavelength of approximately 610 nm, generating a bright red fluorescence signal that can be clearly distinguished from GFP and YFP signals. This makes it particularly suitable for multicolor fluorescence imaging and multiplexed reporter assays.

This product is an N1-Me-pUTP modified mCherry mRNA synthesized through in vitro co-transcriptional capping (IVT). The incorporation of modified nucleotides enhances mRNA stability, improves translation efficiency, and helps reduce innate immune recognition. The product is purified through precipitation and desalting processes, with a theoretical length of 997 nt, providing sustained protein expression in mammalian cells.

Encoded Protein Amino Acid Sequence:

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGN*

Key Features

N1-Me-pUTP Modified mRNA Technology

Incorporates N1-methylpseudouridine (N1-Me-pUTP) modification to improve mRNA performance and support efficient protein production.

Enhanced Translation Efficiency

Provides sustained and robust mCherry protein expression in mammalian cells compared with unmodified mRNA.

Reduced Innate Immune Activation

Modified nucleotides help minimize unwanted immune stimulation, making it suitable for advanced mRNA research applications.

Superior Fluorescent Reporter Performance

Produces bright red fluorescence with excellent photostability for microscopy imaging and quantitative fluorescence analysis.

Reliable Manufacturing & Customization

Produced under strict quality control with short lead time and flexible customization options.

Applications

• Evaluation of modified mRNA delivery platforms

• Lipid nanoparticle (LNP) transfection studies

• mRNA translation efficiency assessment

• Fluorescent protein expression analysis

• Cell tracking and protein localization studies

• Multicolor fluorescence imaging

• In vivo mRNA expression and delivery studies

Performance Data

Cellular Expression Performance

mCherry mRNA (modified) demonstrates efficient translation and strong red fluorescence expression in mammalian cell transfection experiments.

mRNA Stability Evaluation

Stability of mCherry mRNA (modified) Bulk Solution at 2–8°C

Maintains molecular integrity and biological activity during refrigerated storage.

Freeze-Thaw Stability of mCherry mRNA (modified) Bulk Solution

Retains expression performance after multiple freeze-thaw cycles.

Long-Term Stability of mCherry mRNA (modified) Bulk Solution at -80°C

Supports long-term storage and repeated experimental use.

FAQ

Q1: What modification is used in mCherry mRNA (modified)?

mCherry mRNA (modified) contains N1-Me-pUTP modification, a commonly used nucleotide modification in therapeutic and research mRNA applications.

Q2: Why choose modified mCherry mRNA?

Compared with unmodified mRNA, N1-Me-pUTP modified mRNA generally provides improved translation efficiency, enhanced stability, and reduced innate immune recognition.

Q3: Can mCherry mRNA (modified) be used for LNP delivery studies?

Yes. It is suitable for evaluating LNP formulation efficiency, intracellular delivery, and protein expression performance.

Q4: What are the recommended storage and transportation conditions?

Store at -85°C to -65°C. Transportation is available under -45°C to 25°C conditions.

Related Products