Product Overview

mCherry mRNA encodes mCherry red fluorescent protein, a widely used fluorescent reporter derived from mRFP, an optimized variant of coral-derived DsRed. Compared with the original DsRed and mRFP, mCherry features faster maturation kinetics, enhanced photostability, and improved fluorescence performance, making it an ideal reporter for molecular biology and cell-based research.

The encoded mCherry protein exhibits a maximum excitation wavelength of approximately 587 nm and a maximum emission wavelength of approximately 610 nm, generating a bright red fluorescence signal detectable by fluorescence microscopy. Its distinct spectral properties enable efficient combination with green fluorescent proteins (GFP) and yellow fluorescent proteins (YFP) for multicolor imaging and labeling applications.

This product is an unmodified mCherry mRNA synthesized through in vitro co-transcriptional capping (IVT) and purified by precipitation and desalting processes. With a theoretical length of 997 nt, it provides efficient protein expression in mammalian eukaryotic cells and is suitable as a fluorescent reporter mRNA for evaluating transfection efficiency, gene expression, and delivery systems.

Encoded Protein Amino Acid Sequence:

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKSGN*

Key Features

Bright Red Fluorescent Reporter Expression

Encodes mCherry fluorescent protein with strong red fluorescence emission (~610 nm), enabling direct visualization and quantification of protein expression.

Optimized Fluorescence Properties

mCherry provides faster maturation and higher photostability compared with earlier DsRed-derived fluorescent proteins, supporting long-term imaging applications.

Validated Cellular Expression Performance

Demonstrates reliable protein expression in mammalian cells, suitable for evaluating mRNA delivery efficiency and transfection performance.

Flexible Research Applications

Compatible with fluorescence microscopy, reporter assays, and multicolor labeling experiments alongside GFP/YFP reporters.

Reliable Supply & Customization Support

Manufactured with strict quality control. Short lead time and customization services are available to meet different research requirements.

Applications

• Fluorescent reporter assays for mRNA expression analysis

• Evaluation of mRNA transfection and delivery efficiency

• Cell labeling and protein localization studies

• Multicolor fluorescence imaging with GFP/YFP reporters

• Gene expression regulation studies

• Cell-based assay development

• In vivo fluorescence tracking studies

Performance Data

Cellular Expression Validation

mCherry mRNA enables efficient expression of red fluorescent protein in mammalian cells, producing detectable fluorescence signals after transfection.

mRNA Stability Assessment

Stability of mCherry mRNA Bulk Solution at 2–8°C

Demonstrates stable storage performance under refrigerated conditions.

Freeze-Thaw Stability of mCherry mRNA Bulk Solution

Maintains mRNA integrity and expression capability after repeated freeze-thaw cycles.

Long-Term Stability of mCherry mRNA Bulk Solution at -80°C

Supports long-term storage under recommended frozen conditions.

FAQ

Q1: What is mCherry mRNA used for?

mCherry mRNA is primarily used as a red fluorescent reporter to evaluate mRNA delivery efficiency, protein expression, cellular localization, and multicolor imaging applications.

Q2: What is the difference between mCherry mRNA and mCherry mRNA (modified)?

mCherry mRNA contains standard nucleotides, while mCherry mRNA (modified) incorporates N1-Me-pUTP modification to improve translation efficiency and reduce innate immune activation.

Q3: What is the recommended storage condition for mCherry mRNA?

Store at -85°C to -65°C. Transportation is available under -45°C to 25°C conditions.

Q4: How stable is the product during storage?

The mCherry mRNA bulk solution is stable for 1 month at 2–8°C and tolerates more than 10 freeze-thaw cycles.

Related Products