Product Overview

eGFP mRNA (Modified) is an N1-Me-pUTP modified messenger RNA encoding enhanced green fluorescent protein (EGFP), designed to improve mRNA translation performance and reduce innate immune activation after cellular delivery.

EGFP is a widely used fluorescent reporter protein with an excitation wavelength of 488 nm and an emission wavelength of 507 nm. The strong green fluorescence signal enables direct visualization of protein expression in living cells through fluorescence microscopy without additional substrates.

This product is synthesized by in vitro co-transcriptional capping technology incorporating N1-methylpseudouridine (N1-Me-pUTP) modification. Compared with unmodified mRNA, modified eGFP mRNA provides enhanced translation efficiency and improved cellular compatibility, making it suitable for advanced mRNA delivery studies and functional validation applications.

With a theoretical length of approximately 997 nt, the product is purified through precipitation and desalting processes and supports sustained EGFP expression in mammalian eukaryotic cells.

The encoded EGFP protein sequence is:

Amino Acid Sequence of Encoded Protein：

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*

Key Features

N1-Me-pUTP Modified mRNA Technology

Incorporates N1-methylpseudouridine modification to improve mRNA performance and support efficient protein translation.

Enhanced Protein Expression Capability

Validated through cellular expression assays, modified eGFP mRNA demonstrates strong EGFP expression performance after transfection.

Reduced Innate Immune Recognition

Modified nucleoside incorporation helps reduce unwanted cellular immune responses commonly associated with exogenous RNA.

Excellent Stability and Handling Performance

Stable for 1 month at 2–8°C and tolerates more than 10 freeze-thaw cycles.

Flexible Supply and Customization Options

Available with reliable supply capacity, short lead times, and customized mRNA design services.

Applications

eGFP mRNA (Modified) is suitable for:

• mRNA delivery platform evaluation

• Lipid nanoparticle (LNP) formulation development

• mRNA vaccine and therapeutic research

• Cellular transfection optimization

• Reporter gene expression analysis

• Protein expression studies

• In vivo animal experiments

Performance Data

Time-Dependent eGFP Protein Expression in Various Cell Lines

Stability of mRNA Bulk Solution at 2–8°C

The product remains stable for at least 1 month under refrigerated storage conditions.

Freeze-Thaw Stability

Maintains functional activity after more than 10 freeze-thaw cycles, supporting routine laboratory handling.

Long-Term Storage Stability at -80°C

Maintains mRNA integrity and biological activity during long-term storage at ultra-low temperatures.

FAQ

Q1: What is N1-Me-pUTP modified eGFP mRNA?

N1-Me-pUTP modified eGFP mRNA is an mRNA molecule containing N1-methylpseudouridine modification, which improves translation efficiency and enhances cellular compatibility.

Q2: What is the advantage of modified eGFP mRNA compared with unmodified eGFP mRNA?

Modified eGFP mRNA generally provides stronger protein expression performance and reduced innate immune recognition, making it suitable for applications requiring improved mRNA activity.

Q3: Can modified eGFP mRNA be used for LNP delivery studies?

Yes. It is suitable for evaluating LNP-based mRNA delivery systems, formulation optimization, and intracellular expression analysis.

Q4: What are the storage and transportation conditions?

Recommended storage temperature is -85°C to -65°C. Transportation conditions are -45°C to 25°C.

Related Products