Product Overview

Human erythropoietin (EPO) is an endogenous glycoprotein hormone primarily secreted by the kidney. It plays a critical role in regulating erythropoiesis by promoting the survival, proliferation, and differentiation of erythroid progenitor cells in the bone marrow, thereby stimulating red blood cell production and enhancing oxygen-carrying capacity.

Recombinant human EPO (rhEPO) is widely used in research and clinical applications, particularly for studying erythropoietin signaling pathways, erythroid differentiation, and anemia-related mechanisms.

This product is a N1-methylpseudouridine (N1-Me-pUTP) modified Human EPO mRNA synthesized by in vitro co-transcriptional capping technology. The mRNA contains optimized modifications designed to reduce innate immune activation and improve translation efficiency in mammalian cells.

The product has a theoretical length of 848 nt and encodes the full-length human EPO protein. It is purified through precipitation and desalting processes to ensure high-quality mRNA suitable for cell-based assays and in vivo research applications.

Amino Acid Sequence of Encoded Protein：

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR*

Key Features

Enhanced Translation Efficiency

N1-methylpseudouridine modification improves mRNA translation performance and supports robust protein expression in mammalian eukaryotic cells.

Reduced Innate Immune Activation

Modified nucleosides help minimize recognition by innate immune sensors, making it suitable for applications requiring improved mRNA tolerability.

Excellent Stability

Stable for at least 1 month at 2–8°C

Tolerates more than 10 freeze-thaw cycles

Long-term storage at -80°C

Validated Protein Expression Performance

Cell-based expression assays demonstrate strong Human EPO protein expression capability compared with unmodified mRNA products.

Flexible Supply & Customization

• Short lead time

• Multiple scale options available

• Custom sequence design and modification services supported

Applications

Human EPO mRNA (modified) is suitable for:

• Protein expression studies in mammalian cells

• Erythropoiesis and hematopoietic differentiation research

• EPO signaling pathway studies

• Cell-based functional assays

• mRNA delivery system evaluation

• In vivo animal studies

• mRNA therapeutic research and development

Performance Data

Detection of Human EPO Protein Expression by Western Blot Analysis

Detection of Intracellular and Secreted hEPO Expression by Western Blot

Stability of Human EPO mRNA Bulk Solution at 2–8°C

The modified Human EPO mRNA maintains excellent stability during refrigerated storage, supporting flexible laboratory handling and transportation.

Freeze-Thaw Stability of Human EPO mRNA Bulk Solution

The product maintains mRNA integrity and translation activity after multiple freeze-thaw cycles, demonstrating strong formulation stability.

Long-Term Stability of Human EPO mRNA Bulk Solution at -80°C

Long-term storage under ultra-low temperature conditions preserves mRNA quality and performance.

FAQ

Q1: What modification is used in this Human EPO mRNA product?

A: This product contains N1-methylpseudouridine (N1-Me-pUTP) modification, which can improve translation efficiency and reduce innate immune activation.

Q2: What is the recommended storage condition?

A: The recommended storage temperature is -85°C to -65°C.

Q3: How is the product shipped?

A: The product supports transportation conditions from -45°C to 25°C.

Q4: Can this product be customized?

A: Yes. Custom sequence design, modification options, and production scale services are available.

Related Products