Product Overview

EGFP saRNA (Self-amplifying RNA encoding enhanced green fluorescent protein) is designed to achieve robust and sustained EGFP expression in mammalian cells through an RNA self-amplification mechanism. After transfection, the saRNA replicase system generates RNA-dependent RNA polymerase (RDRP)-mediated amplification, significantly enhancing intracellular RNA levels and protein expression compared with conventional mRNA.

EGFP is an enhanced variant of green fluorescent protein (GFP), optimized for strong fluorescence intensity and reliable detection. It has an excitation wavelength of approximately 488 nm and an emission wavelength of approximately 507 nm, producing a bright green fluorescence signal that can be directly monitored by fluorescence microscopy without cell disruption or additional substrates.

Unlike conventional mRNA, EGFP saRNA contains viral-derived replicase elements that enable self-replication through RNA-dependent RNA polymerase activity. The subgenomic promoter (SGP) selectively drives transcription of the gene of interest (GOI), allowing efficient production and translation of EGFP mRNA while bypassing replicase coding regions. This self-amplifying mechanism enables effective protein expression with a substantially reduced RNA dosage requirement compared with standard mRNA platforms.

This EGFP saRNA product is synthesized by in vitro co-transcriptional capping without modified nucleotides and purified through precipitation and desalting processes. With a theoretical length of 8,443 nt, it demonstrates stable translation performance in mammalian eukaryotic cells and is suitable as a fluorescent reporter tool for RNA delivery, gene expression analysis, and cell-based research applications.

Amino Acid Sequence of Encoded Protein：

MREAQTNYLPKMEKVHVDIEEDSPFLRALQRSFPQFEVEAKQVTDNDHANARAFSHLASKLIETEVDPSDTILDIGSAPARRMYSKHKYHCICPMRCAEDPDRLYKYATKLKKNCKEITDKELDKKMKELAAVMSDPDLETETMCLHDDESCRYEGQVAVYQDVYAVDGPTSLYHQANKGVRVAYWIGFDTTPFMFKNLAGAYPSYSTNWADETVLTARNIGLCSSDVMERSRRGMSILRKKYLKPSNNVLFSVGSTIYHEKRDLLRSWHLPSVFHLRGKQNYTCRCETIVSCDGYVVKRIAISPGLYGKPSGYAATMHREGFLCCKVTDTLNGERVSFPVCTYVPATLCDQMTGILATDVSADDAQKLLVGLNQRIVVNGRTQRNTNTMKNYLLPVVAQAFARWAKEYKEDQEDERPLGLRDRQLVMGCCWAFRRHKITSIYKRPDTQTIIKVNSDFHSFVLPRIGSNTLEIGLRTRIRKMLEEHKEPSPLITAEDVQEAKCAADEAKEVREAEELRAALPPLAADVEEPTLEADVDLMLQEAGAGSVETPRGLIKVTSYDGEDKIGSYAVLSPQAVLKSEKLSCIHPLAEQVIVITHSGRKGRYAVEPYHGKVVVPEGHAIPVQDFQALSESATIVYNEREFVNRYLHHIATHGGALNTDEEYYKTVKPSEHDGEYLYDIDRKQCVKKELVTGLGLTGELVDPPFHEFAYESLRTRPAAPYQVPTIGVYGVPGSGKSGIIKSAVTKKDLVVSAKKENCAEIIRDVKKMKGLDVNARTVDSVLLNGCKHPVETLYIDEAFACHAGTLRALIAIIRPKKAVLCGDPKQCGFFNMMCLKVHFNHEICTQVFHKSISRRCTKSVTSVVSTLFYDKKMRTTNPKETKIVIDTTGSTKPKQDDLILTCFRGWVKQLQIDYKGNEIMTAAASQGLTRKGVYAVRYKVNENPLYAPTSEHVNVLLTRTEDRIVWKTLAGDPWIKTLTAKYPGNFTATIEEWQAEHDAIMRHILERPDPTDVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNSYKLSSTLTNIYTGSRLHEAGCAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREAVEEICISDDSSVTEPDAELVRVHPKSSLAGRKGYSTSDGKTFSYLEGTKFHQAAKDIAEINAMWPVATEANEQVCMYILGESMSSIRSKCPVEESEASTPPSTLPCLCIHAMTPERVQRLKASRPEQITVCSSFPLPKYRITGVQKIQCSQPILFSPKVPAYIHPRKYLVETPPVDETPEPSAENQSTEGTPEQPPLITEDETRTRTPEPIIIEEEEEDSISLLSDGPTHQVLQVEADIHGPPSVSSSSWSIPHASDFDVDSLSILDTLEGASVTSGATSAETNSYFAKSMEFLARPVPAPRTVFRNPPHPAPRTRTPSLAPSRACSRTSLVSTPPGVNRVITREELEALTPSRTPSRSVSRTSLVSNPPGVNRVITREEFEAFVAQQQ*

MKAITARRILQGLGHYLKAEGKVECYRTLHPVPLYSSSVNRAFSSPKVAVEACNAMLKENFPTVASYCIIPEYDAYLDMVDGASCCLDTASFCPAKLRSFPKKHSYLEPTIRSAVPSAIQNTLQNVLAAATKRNCNVTQMRELPVLDSAAFNVECFKKYACNNEYWETFKENPIRLTEENVVNYITKLKGPKAAALFAKTHNLNMLQDIPMDRFVMDLKRDVKVTPGTKHTEERPKVQVIQAADPLATAYLCGIHRELVRRLNAVLLPNIHTLFDMSAEDFDAIIAEHFQPGDCVLETDIASFDKSEDDAMALTALMILEDLGVDAELLTLIEAAFGEISSIHLPTKTKFKFGAMMKSGMFLTLFVNTVINIVIASRVLRERLTGSPCAAFIGDDNIVKGVKSDKLMADRCATWLNMEVKIIDAVVGEKAPYFCGGFILCDSVTGTACRVADPLKRLFKLGKPLAADDEHDDDRRRALHEESTRWNRVGILSELCKAVESRYETVGTSIIVMAMTTLASSVKSFSYLRGAPITLYG*

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*

Key Features

Enhanced Protein Expression Through Self-Amplifying RNA Technology

The saRNA platform enables intracellular RNA amplification through replicase-mediated replication, providing higher protein expression efficiency with lower RNA input compared with conventional mRNA.

Bright and Reliable EGFP Fluorescence Signal

EGFP produces strong green fluorescence with excitation at approximately 488 nm and emission at approximately 507 nm, enabling convenient real-time visualization of protein expression in living cells.

Validated Cellular Expression Performance

Cell-based expression assays demonstrate efficient EGFP protein production and robust fluorescence signals, supporting reliable evaluation of transfection efficiency and RNA performance.

High Stability and Reliable Quality

• Stable storage performance at 2–8°C for up to 1 month

• Tolerates more than 10 freeze-thaw cycles

• Synthesized through optimized in vitro transcription and purification processes

Flexible Supply and Customization Services

Provides short lead times and customized saRNA design services to meet diverse research requirements.

Applications

EGFP saRNA is suitable for a wide range of RNA research and molecular biology applications, including:

RNA delivery system evaluation

Assessment of saRNA delivery efficiency and intracellular expression performance

Gene expression and regulation studies

Monitoring RNA translation efficiency and expression dynamics

Fluorescent reporter assays

Direct visualization of protein expression using fluorescence microscopy

Cell transfection and optimization studies

Evaluation of transfection reagents, delivery platforms, and experimental conditions

Protein localization and trafficking studies

Investigation of intracellular protein expression and distribution

In vivo expression studies

Supporting animal model studies requiring fluorescent protein expression analysis

Performance Data

Time- and Dose-Dependent EGFP Expression Mediated by saRNA

Long-term Stability of EGFP saRNA Bulk Solution at -80°C

EGFP saRNA bulk solution demonstrates excellent long-term stability when stored under recommended conditions. Stability evaluation at -80°C confirms consistent product performance and reliable RNA quality during storage.

FAQ

Q1. What is EGFP saRNA?

EGFP saRNA is a self-amplifying RNA molecule encoding enhanced green fluorescent protein (EGFP). Unlike conventional mRNA, saRNA contains replicase elements that enable intracellular RNA amplification, resulting in enhanced and sustained protein expression.

Q2. How does EGFP saRNA differ from conventional EGFP mRNA?

EGFP mRNA directly serves as a template for protein translation, while EGFP saRNA contains additional replicase sequences that enable RNA self-amplification inside cells. This mechanism can achieve higher protein expression with a lower RNA dosage.

Q3. Does EGFP saRNA contain modified nucleotides?

No. This product is synthesized by in vitro co-transcriptional capping without modified nucleotides.

Q4. What is the recommended storage condition for EGFP saRNA?

EGFP saRNA should be transported under -45°C to 25°C and stored at -85°C to -65°C.

Q5. What are the recommended applications of EGFP saRNA?

EGFP saRNA is suitable for cell-based expression assays, RNA delivery evaluation, reporter gene studies, transfection optimization, and in vivo animal research.

Q6. Is customization service available?

Yes. Customized saRNA design and production services are available to support different research applications and experimental requirements.

Related Products