Product Overview

COVID-19 RBD (1000 nt) mRNA (modified) is an N1-Methylpseudouridine (N1-Me-pUTP) modified mRNA encoding the receptor-binding domain (RBD) of the SARS-CoV-2 spike glycoprotein.

The RBD domain is the major functional region involved in binding to the host ACE2 receptor and plays a key role in SARS-CoV-2 infection initiation. Due to its importance in viral entry, immune recognition, and antibody targeting, SARS-CoV-2 RBD mRNA is widely applied in studies of viral mechanisms, antigen expression, and mRNA-based therapeutic and vaccine development.

This modified mRNA product is generated through in vitro transcription using N1-Me-pUTP incorporation technology and co-transcriptional capping. The modification strategy helps improve mRNA stability, enhance translation efficiency, and reduce innate immune activation in mammalian cells.

The product is purified through precipitation and desalting processes and has a theoretical transcript length of approximately 1050 nt, providing sustained protein expression performance for advanced cellular and animal studies.

Encoded Protein Amino Acid Sequence:

MDAMKRGLCCVLLLCGAVFVSARVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFHHHHHH*

Key Features

N1-Me-pUTP Modified mRNA for Enhanced Performance

• Incorporates N1-methylpseudouridine modification technology.

• Improves mRNA stability and translation efficiency.

• Helps reduce innate immune recognition in mammalian cells.

Efficient Protein Expression Capability

• Validated through cellular expression assays.

• Provides higher protein expression levels compared with unmodified mRNA products.

Excellent Stability Profile

• Stable for at least 1 month at 2–8°C.

• Tolerates more than 10 freeze-thaw cycles.

• Maintains functional activity during storage and handling.

Reliable Manufacturing and Customization Support

• Produced using controlled IVT manufacturing processes.

• Supports customized mRNA sequence design and modification services.

• Suitable for research applications from early-stage studies to advanced development.

Applications

COVID-19 RBD (1000 nt) mRNA (modified) is designed for applications including:

• SARS-CoV-2 antigen expression research

• mRNA vaccine development studies

• Cell-based translation and expression assays

• Immune response evaluation

• Virus-host interaction analysis

• Preclinical animal studies

• mRNA platform development

Performance Data

Cellular Expression Validation

N1-Me-pUTP modified COVID-19 RBD mRNA demonstrates enhanced protein expression performance in mammalian cell expression assays.

Stability of mRNA Bulk Solution at 2–8°C

The product maintains mRNA integrity during refrigerated storage, enabling convenient laboratory handling.

Freeze-Thaw Stability Assessment

The modified mRNA maintains stability after repeated freeze-thaw cycles, supporting multiple experimental workflows.

Long-Term Stability at -80°C

The product shows reliable long-term preservation performance under recommended ultra-low temperature storage conditions.

FAQ

What modification is used in this mRNA product?

This product incorporates N1-methylpseudouridine (N1-Me-pUTP) modification during in vitro transcription.

What are the advantages of N1-Me-pUTP modification?

N1-Me-pUTP modification can improve mRNA translation efficiency, enhance stability, and reduce innate immune activation, making it widely used in mRNA therapeutic and vaccine research.

What are the recommended storage conditions?

Recommended storage temperature: -85°C to -65°C.

How is the product transported?

Recommended transportation temperature range: -45°C to 25°C.

Can Hzymes provide customized modified mRNA services?

Yes. Hzymes provides customized mRNA synthesis services, including sequence optimization, nucleotide modification, and production scale-up support.

Related Products